General Information

  • ID:  hor005483
  • Uniprot ID:  P18830
  • Protein name:  Adipokinetic hormone precursor-related peptide alpha chain
  • Gene name:  NA
  • Organism:  Schistocerca nitens (Vagrant locust) (Gray bird grasshopper)
  • Family:  AKH/HRTH/RPCH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Schistocerca (genus), Cyrtacanthacridinae (subfamily), Acrididae (family), Acridoidea (superfamily), Acridomorpha, Acrididea (infraorder), Caelifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007629 flight behavior
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DAGDYGDPYSFLYRLIQAEARKMSGCSN
  • Length:  28(36-63)
  • Propeptide:  MVQRCLVVALLVVVVAAALCSAQLNFTPNWGTGKRDAGDYGDPYSFLYRLIQAEARKMSGCSN
  • Signal peptide:  MVQRCLVVALLVVVVAAALCSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This hormone, released from cells in the corpora cardiaca, causes release of diglycerides from the fat body and stimulation of muscles to use these diglycerides as an energy source during energy-demanding processes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  26-26
  • Structure ID:  AF-P18830-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005483_AF2.pdbhor005483_ESM.pdb

Physical Information

Mass: 361022 Formula: C135H203N37O45S2
Absent amino acids: HTVW Common amino acids: ADGSY
pI: 4.5 Basic residues: 3
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: -65.36 Boman Index: -6154
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 52.5
Instability Index: 2790.71 Extinction Coefficient cystines: 4470
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  2294116
  • Title:  The structurally similar neuropeptides adipokinetic hormone I and II are derived from similar, very small mRNAs.